PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_024259-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family MYB_related
Protein Properties Length: 226aa    MW: 25272.2 Da    PI: 6.7629
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_024259-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding31.25.2e-1065107145
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      ++ +T++E+ l+++  ++lG + W++Ia ++  gRt++++  +w 
    NNU_024259-RA  65 KLEFTEDEETLIARMYNLLGDR-WSLIAGRIA-GRTAEEIEKYWT 107
                      678*****************99.*********.***********5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512949.30760114IPR017930Myb domain
SMARTSM007172.0E-864112IPR001005SANT/Myb domain
PfamPF002491.1E-866107IPR001005SANT/Myb domain
SuperFamilySSF466896.93E-867111IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.1E-1167108IPR009057Homeodomain-like
CDDcd001673.16E-767106No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 226 aa     Download sequence    Send to blast
MSRKTEVCCL ISILLNVSAS MLLAIGMLLN FQGAWPIWIA PLTIPLWILG VLFYVCIEET  60
SHGSKLEFTE DEETLIARMY NLLGDRWSLI AGRIAGRTAE EIEKYWTSRY STNYIPNDAV  120
QRQRKKYWPS SDTVAEESTA IIDEISATKE CILCLVGAPT SLEISATDQT LANVLQGLSL  180
GAPGSDSRHH LPLQIQMTSK KSSNKKQTPI RKAIKILKDD KENIDK
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010248700.19e-72PREDICTED: transcription factor TRY-like
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G46410.15e-16MYB_related family protein